Protein Info for MMP_RS03995 in Methanococcus maripaludis S2

Annotation: flippase-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 15 to 305 (291 residues), 172.7 bits, see alignment E=6.5e-55 TIGR00374: TIGR00374 family protein" amino acids 17 to 315 (299 residues), 184 bits, see alignment E=2.4e-58

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to mmp:MMP0767)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ62 at UniProt or InterPro

Protein Sequence (316 amino acids)

>MMP_RS03995 flippase-like domain-containing protein (Methanococcus maripaludis S2)
VDTLKKQFLNKKTYLSFLISFLILYWIFSKIDFYLLVSSIKNTNLIWFFVAFGCFYASVF
LKSIRWKLLLNDAEINIGLKDSFLIFYLSMFANAIVPAKIGDIYRSYLLKQKNSAPISLS
FATVFVERIFDLMTMIPLLLIFGIISFNANIPLEILLALKYGLVLIVLLISFTLIFLKFN
SNIMKKINNKLIKNIFTNFEKGIRTLKVKSIPKLFLLSLISWITEGFTIYFIFLSIGLNF
DILFSIFTDLSSSLLTAIPFTPSGLGIVEYALVFILNLKNTGITESSVVIVLYRAISYFS
IVILGSIAHFMYGIKK