Protein Info for MMP_RS03865 in Methanococcus maripaludis S2

Annotation: aspartate/glutamate racemase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00035: aspartate racemase
  • amino acids 1 to 231 (231 residues), 247.7 bits, E=5.7e-78
• PF01177: Asp_Glu_race
  • amino acids 7 to 224 (218 residues), 150.7 bits, E=2.5e-48

Best Hits

Swiss-Prot: 48% identical to YGEA_ECO57: L-aspartate/glutamate-specific racemase (ygeA) from Escherichia coli O157:H7

KEGG orthology group: K01779, aspartate racemase [EC: 5.1.1.13] (inferred from 100% identity to mmp:MMP0739)

MetaCyc: 48% identical to amino acid racemase YgeA (Escherichia coli K-12 substr. MG1655)
5.1.1.-

Predicted SEED Role

"Aspartate racemase (EC 5.1.1.13)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 5.1.1.13)

KEGG Metabolic Maps

• Alanine and aspartate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.13

Sequence Analysis Tools

See Q6LZ90 at UniProt or InterPro

Protein Sequence (234 amino acids)

>MMP_RS03865 aspartate/glutamate racemase family protein (Methanococcus maripaludis S2)
MKTIGLIGGLSWESTQEYYRIINQSIRDKLGAPHSAKCILYSVDFAEFDKLSHDEEWDVI
AEKLTDIAKTLEKAGAEGILICTNTMHTVADSVSENINIPLVHIVDAVAEDIKQKNIKKV
GLLGTKFTMEQEFYSGRLKEKHEIDVIIPSDEERDVVHNVIYKELVSGIIKEESRQKYLK
IIDNLVENGAEGIILGCTEIPLLIKQEHCSTVIFDTSKIHAESAVEFVLKDSKL