Protein Info for MMP_RS03855 in Methanococcus maripaludis S2

Annotation: aspartate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 2 to 92 (91 residues), 36.2 bits, see alignment E=1.8e-12 PF03807: F420_oxidored" amino acids 3 to 96 (94 residues), 26.8 bits, see alignment E=1.3e-09 PF03447: NAD_binding_3" amino acids 8 to 121 (114 residues), 108.8 bits, see alignment E=5.6e-35 TIGR03855: aspartate dehydrogenase" amino acids 28 to 265 (238 residues), 277.5 bits, see alignment E=4e-87 PF01958: Asp_DH_C" amino acids 167 to 253 (87 residues), 100 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 100% identical to ASPD_METMP: Probable L-aspartate dehydrogenase (nadX) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06989, aspartate dehydrogenase [EC: 1.4.1.21] (inferred from 100% identity to mmp:MMP0737)

Predicted SEED Role

"L-Aspartate dehydrogenase (EC 1.4.1.21)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZ92 at UniProt or InterPro

Protein Sequence (267 amino acids)

>MMP_RS03855 aspartate dehydrogenase (Methanococcus maripaludis S2)
MLKIGLVGCGAIASLITKALMSDRLNKAEVLAFYDGNLEKAEKLAMETGADFCKSLDELV
SKDLDLIVECASVNAVEDTVIKSLNNDKDVIIMSVGAFADKDLFVKLYKLAEKLGKKIYV
PSGAVAGIDAVKSGSLGKISEVSLTTTKPVHGLKSALEEQGLNTDEIKEPKIVFEGTVFD
AISKFPQNINVSVVLSLASRYPAKVKIIADPNAVVNRHEILVKGSIGTIKTCVENNPCRD
NPKTSALAAYSVIRLIKDLSEPVRIGT