Protein Info for MMP_RS03705 in Methanococcus maripaludis S2
Annotation: (5-formylfuran-3-yl)methyl phosphate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MFNB_METMP: (5-formylfuran-3-yl)methyl phosphate synthase (mfnB) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K09733, hypothetical protein (inferred from 100% identity to mmp:MMP0708)MetaCyc: 74% identical to 2-furaldehyde phosphate synthase monomer (Methanocaldococcus jannaschii)
RXN-15946 [EC: 4.2.3.153]
Predicted SEED Role
"duf556 family protein"
MetaCyc Pathways
- methanofuran biosynthesis (4/8 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.3.153
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZC1 at UniProt or InterPro
Protein Sequence (236 amino acids)
>MMP_RS03705 (5-formylfuran-3-yl)methyl phosphate synthase (Methanococcus maripaludis S2) MILLVSPKDVAEAYEAIEGGADIIDVKNPPEGSLGANFPWVIKETREATPEGMLVSAAIG DVPYKPGTVTLAALGATVSGADYIKVGLYGTRSYQEALDVMKNVTKAVKDAGENKIVVAA GYADAYRVGAVDPLVIPKVARDAGCDVAMLDTAVKDGKTLFDHMDLDLLREFVEETHKYG MKCALAGSIKIEEIPMLKEIGCDIVGVRGAACTQGDRNAGRIQKDLVKEIVKVCRD