Protein Info for MMP_RS03675 in Methanococcus maripaludis S2

Annotation: RimK family alpha-L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 TIGR00768: alpha-L-glutamate ligase, RimK family" amino acids 4 to 284 (281 residues), 238.6 bits, see alignment E=4.2e-75 PF08443: RimK" amino acids 96 to 283 (188 residues), 117.9 bits, see alignment E=6.6e-38 PF02955: GSH-S_ATP" amino acids 113 to 272 (160 residues), 49.3 bits, see alignment E=6.1e-17

Best Hits

Swiss-Prot: 100% identical to MPTN_METMP: Tetrahydromethanopterin:alpha-L-glutamate ligase (mptN) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 100% identity to mmp:MMP0702)

MetaCyc: 50% identical to tetrahydrosarcinapterin synthase monomer (Methanocaldococcus jannaschii)
RXN-11103 [EC: 6.3.2.33]

Predicted SEED Role

"Tetrahydromethanopterin:alpha-L-glutamate ligase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZC7 at UniProt or InterPro

Protein Sequence (292 amino acids)

>MMP_RS03675 RimK family alpha-L-glutamate ligase (Methanococcus maripaludis S2)
MRMGIISEERDWVTDELKSKMEKNDIDPVIIQPSKIISYIESEVKFEQNNRSILDLKCAF
VRNIGEGVEMFHRFDMLKYLENYVPIINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAE
DVNKALIAADKFEDVVLKPLFGNQGKGLVRVKGRSTVAKLKALNTFKSTHGVIYMQEFVN
NPNNVYRDIRAFVVGDKVISAMYRTSDNWITNIHQNGVPEKCEITEELSKIVLAAKDAVG
LVYAGVDILESSDGLKVIEVNACPSWEGLSRISEVDIAQNLIDEALNYAKEY