Protein Info for MMP_RS03645 in Methanococcus maripaludis S2

Annotation: proline--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00408: proline--tRNA ligase
  • amino acids 2 to 446 (445 residues), 604.8 bits, E=6.2e-186
• PF00587: tRNA-synt_2b
  • amino acids 92 to 263 (172 residues), 106 bits, E=3.7e-34
• PF03129: HGTP_anticodon
  • amino acids 280 to 373 (94 residues), 69.2 bits, E=4.3e-23
• PF09181: ProRS-C_2
  • amino acids 394 to 460 (67 residues), 119.3 bits, E=9.2e-39

Best Hits

Swiss-Prot: 100% identical to SYP_METMP: Proline--tRNA ligase (proS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 100% identity to mmp:MMP0696)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), archaeal/eukaryal type" (EC 6.1.1.15)

MetaCyc Pathways

• tRNA charging (19/21 steps found)
• pyoluteorin biosynthesis (1/7 steps found)
• ergotamine biosynthesis (4/12 steps found)
• (2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
• clorobiocin biosynthesis (1/10 steps found)
• superpathway of ergotamine biosynthesis (5/18 steps found)
• pyrrolomycin biosynthesis (1/14 steps found)
• sulfazecin biosynthesis (1/16 steps found)
• phosalacine biosynthesis (1/25 steps found)
• phosphinothricin tripeptide biosynthesis (1/25 steps found)
• colibactin biosynthesis (6/38 steps found)

KEGG Metabolic Maps

• Aminoacyl-tRNA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

See Q6LZD3 at UniProt or InterPro

Protein Sequence (460 amino acids)

>MMP_RS03645 proline--tRNA ligase (Methanococcus maripaludis S2)
MEFSEWYSDILEKAGIYDLRYPIKGCGVYLPYGFKIRRYSFEILRKLLDETGHDETLFPM
LIPENLLAKEGEHIKGFEDEVFWVTHGGKTPLEVKLALRPTSETTMYYMMKQWIKVHTDL
PLKLYQVVNTFRYETKHTRPLIRLREIMSFKEAHTAHATKKECDAQIEEALTLYKAFFDE
IGVPYVISKRPEWDKFPGADYTMAFDTIYPDGKTMQIGTVHNLGQNFAKTFELEFETPDG
EKDFVYQTCYGISDRAIASLISVHGDEKGLVIPVDVAPIQIVLIPLLFKGKEEIVMDKIK
ELNNTLKSEFRVHLDDRDIRPGRKYNDWELKGVPLRIELGPRDIENGHALIVRRDTGEKI
TVEYSNILEEVEKIVSMYKENLKLKAEEKVKSFITVLDFENDVNSLSEKVKAKLLENKGI
ILIPFNESIYNEEFEELIDASVLGLTTYEGKEYISVARTY