Protein Info for MMP_RS03595 in Methanococcus maripaludis S2

Annotation: 2-amino-3 7-dideoxy-D-threo-hept-6-ulosonate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01949: predicted phospho-2-dehydro-3-deoxyheptonate aldolase
  • amino acids 10 to 268 (259 residues), 408.2 bits, E=7.9e-127
• PF01791: DeoC
  • amino acids 27 to 243 (217 residues), 259 bits, E=2e-81

Best Hits

Swiss-Prot: 100% identical to ADHS_METMP: 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (aroA') from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] K11645, 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonic acid synthase [EC: 4.1.2.-] (inferred from 100% identity to mmp:MMP0686)

MetaCyc: 75% identical to 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase monomer (Methanocaldococcus jannaschii)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; RXN-10031 [EC: 4.1.2.13, 2.2.1.10]

Predicted SEED Role

"2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase (EC 2.5.1.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.-)

MetaCyc Pathways

• chorismate biosynthesis II (archaea) (12/12 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• glycolysis V (Pyrococcus) (10/10 steps found)
• 3-dehydroquinate biosynthesis II (archaea) (7/7 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (8/9 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• glycolysis III (from glucose) (8/11 steps found)
• sedoheptulose bisphosphate bypass (1/2 steps found)
• homolactic fermentation (8/12 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• oxygenic photosynthesis (10/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• 1,3-propanediol biosynthesis (engineered) (2/9 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
• superpathway of N-acetylneuraminate degradation (10/22 steps found)
• ethene biosynthesis V (engineered) (12/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Carotenoid biosynthesis - General
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Lysine degradation
• Methionine metabolism
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-, 4.1.2.-, 4.1.2.13

Use Curated BLAST to search for 2.2.1.10 or 2.5.1.- or 4.1.2.- or 4.1.2.13

Sequence Analysis Tools

See Q6LZE3 at UniProt or InterPro

Protein Sequence (272 amino acids)

>MMP_RS03595 2-amino-3 7-dideoxy-D-threo-hept-6-ulosonate synthase (Methanococcus maripaludis S2)
MEMFDNIKNVGKLIRLERIFDKKSEKTVIIPMDHGVSSGPLDGIKDMRITTNAVADGGAN
AVLGHKGLVRHGHRGYGRDIGLIIHMSAGTSISPDPNKKVIVTTVEDAMRMGADAVSLHV
NVGAESDFEMYRDLGLISETCEHWGMPLIAMMYPRGPKIKDEKDPEVVAHAARLGAELGA
DIIKTNYTGDPDTFKEVVKGCPAPIVIAGGPKTNTDEEFLQMVKDAMHAGGKGVASGRNV
FQHKDVKGITSAICKIVHEDVEVEEALKEIKI