Protein Info for MMP_RS03565 in Methanococcus maripaludis S2

Annotation: uracil phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF14681: UPRTase
  • amino acids 15 to 216 (202 residues), 170.8 bits, E=2.8e-54
• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 16 to 217 (202 residues), 239.2 bits, E=1.8e-75
• PF00156: Pribosyltran
  • amino acids 76 to 181 (106 residues), 38.7 bits, E=6.5e-14

Best Hits

Swiss-Prot: 100% identical to UPP_METMP: Uracil phosphoribosyltransferase (upp) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to mmp:MMP0680)

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage II (2/2 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See Q6LZE9 at UniProt or InterPro

Protein Sequence (231 amino acids)

>MMP_RS03565 uracil phosphoribosyltransferase (Methanococcus maripaludis S2)
MIKDERWEGVYSFEDSPYLMETLTNLRNVSTENISFRKGLVRLGRYMGYELTKTMEFEEM
HVQTPLEKTKGIFPKDRSNVVIITILRAAFPLMEGLIKNFESAKVGIVSASRGHAPDFKI
EMNYIKVPQVTPEDTVIVSDPMIATGSTLIHVLKEFKDSKPKRMMIVGVLAAPEGINAVK
AEFPDVEIFVTKIDDKLNNDGYIVPGLGDAGDRAFGEPFKVSMLPQMHNLE