Protein Info for MMP_RS03530 in Methanococcus maripaludis S2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07719: TPR_2
  • amino acids 27 to 57 (31 residues), 23.6 bits, see alignment (E = 3.6e-08)
  • amino acids 162 to 192 (31 residues), 33.9 bits, see alignment (E = 1.7e-11)
  • amino acids 333 to 363 (31 residues), 26.1 bits, see alignment (E = 5.6e-09)
  • amino acids 365 to 395 (31 residues), 29.5 bits, see alignment (E = 4.5e-10)
• PF13181: TPR_8
  • amino acids 37 to 57 (21 residues), 16.7 bits, see alignment (E = 5.7e-06)
  • amino acids 98 to 123 (26 residues), 13.4 bits, see alignment (E = 6.6e-05)
  • amino acids 163 to 192 (30 residues), 22.9 bits, see alignment (E = 5.9e-08)
  • amino acids 197 to 221 (25 residues), 12.3 bits, see alignment (E = 0.00015)
  • amino acids 229 to 261 (33 residues), 14.1 bits, see alignment (E = 4.1e-05)
  • amino acids 265 to 295 (31 residues), 18.6 bits, see alignment (E = 1.4e-06)
  • amino acids 299 to 329 (31 residues), 22.6 bits, see alignment (E = 7.8e-08)
  • amino acids 332 to 363 (32 residues), 23.2 bits, see alignment (E = 4.8e-08)
  • amino acids 366 to 395 (30 residues), 26.7 bits, see alignment (E = 3.6e-09)
• PF13432: TPR_16
  • amino acids 65 to 123 (59 residues), 24.6 bits, E=2.6e-08
  • amino acids 139 to 190 (52 residues), 19.9 bits, 7.6e-07
  • amino acids 235 to 296 (62 residues), 19.4 bits, E=1.1e-06
  • amino acids 302 to 362 (61 residues), 25.6 bits, E=1.2e-08
  • amino acids 345 to 395 (51 residues), 21.5 bits, 2.3e-07
• PF12895: ANAPC3
  • amino acids 71 to 151 (81 residues), 30.5 bits, E=3.3e-10
• PF13176: TPR_7
  • amino acids 94 to 124 (31 residues), 15.7 bits, see alignment (E = 1.2e-05)
  • amino acids 163 to 190 (28 residues), 17.9 bits, see alignment (E = 2.3e-06)
• PF00515: TPR_1
  • amino acids 162 to 192 (31 residues), 38.2 bits, see alignment (E = 7.4e-13)
  • amino acids 298 to 329 (32 residues), 30.1 bits, see alignment (E = 2.8e-10)
  • amino acids 332 to 363 (32 residues), 30.3 bits, see alignment (E = 2.4e-10)
  • amino acids 365 to 395 (31 residues), 41.2 bits, see alignment (E = 8.8e-14)
• PF13174: TPR_6
  • amino acids 166 to 187 (22 residues), 12.4 bits, see alignment (E = 0.0002)
• PF13414: TPR_11
  • amino acids 270 to 306 (37 residues), 38.4 bits, 7e-13
  • amino acids 303 to 343 (41 residues), 35.4 bits, 6.2e-12
• PF13431: TPR_17
  • amino acids 319 to 349 (31 residues), 23.9 bits, see alignment (E = 3.1e-08)
  • amino acids 352 to 384 (33 residues), 22.5 bits, see alignment (E = 8.6e-08)
• PF13424: TPR_12
  • amino acids 332 to 394 (63 residues), 34.2 bits, E=2.1e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0673)

Predicted SEED Role

"GTP cyclohydrolase III (methanopterin)"

Sequence Analysis Tools

See Q6LZF6 at UniProt or InterPro

Protein Sequence (409 amino acids)

>MMP_RS03530 tetratricopeptide repeat protein (Methanococcus maripaludis S2)
MIKLVVVTIFIFSMLLPLPITESSSTYAEMGEQCYLEKDYETSVKCFDKALELDPDNTCS
LEYLGKYSMENRNLDMAEIYFGRLIELEPENKCALKSLGEIHLSQEEYDKALYYYNKLLE
IDNSVGKTWFYKGICLKMLGNYDESVEAFDKSTGDYETLFLTWNDLGYCYYQNGEYDKAI
GCFDKALTLDGNLKYSLNGKGLCCEKKEQYTMAVECFDKAVIQDECYYDAIYNKGISCYK
SKKYSCAISCFEKALDLNNSNPYCYFYKADSLNRLGEYEKAVLNYKKAIELDSKNPIFWS
GLGLSYNYLNEYNSSIQSYEKAVELNPEDDISWSNLGYLQYKNKNYNESISYFEKSLDLN
SNNKYAWNGLGNSYLLLKNYEKALMCYDKAIEIDPLYNEPKISKSSISK