Protein Info for MMP_RS03525 in Methanococcus maripaludis S2

Annotation: ketopantoate reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00745: 2-dehydropantoate 2-reductase" amino acids 2 to 300 (299 residues), 223.3 bits, see alignment E=2.2e-70 PF02558: ApbA" amino acids 3 to 146 (144 residues), 100.4 bits, see alignment E=7.5e-33 PF08546: ApbA_C" amino acids 172 to 299 (128 residues), 110.1 bits, see alignment E=9.6e-36

Best Hits

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 100% identity to mmp:MMP0672)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZF7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>MMP_RS03525 ketopantoate reductase family protein (Methanococcus maripaludis S2)
MNVLIIGAGAVGLCLAAKLSNVADVFAVTRERNAKIIRESGFKMTGIWGDGTYNFETSEN
VPERDFDYIIISSKGLATKSICEQFKDVIKGKNVISIQNGVGNEEIISEYTDKVIGGTII
TGFEWKGDAKVHVSVEGGPMTLGRFPNGTDDEVNTFVKLVKSSGIPIDETENIQGAIWSK
TIYNCALNPLGAVMNVSYGELSNEHSWNLIKNIVYEIFEVTSKKGVILPWKTPEEYLKYL
KEFQLPNTAAHHSSMLQDISKGNITEIDFLNGAVTSIAKEFGIKTPYNEFITEQIKFLEN
LKSKKE