Protein Info for MMP_RS03480 in Methanococcus maripaludis S2

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 262 to 284 (23 residues), see Phobius details amino acids 333 to 354 (22 residues), see Phobius details amino acids 358 to 380 (23 residues), see Phobius details amino acids 391 to 423 (33 residues), see Phobius details PF00916: Sulfate_transp" amino acids 29 to 396 (368 residues), 181.8 bits, see alignment E=1.8e-57 PF01740: STAS" amino acids 440 to 518 (79 residues), 28.5 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0663)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZG5 at UniProt or InterPro

Protein Sequence (539 amino acids)

>MMP_RS03480 SulP family inorganic anion transporter (Methanococcus maripaludis S2)
MNEKINTNETKDLKNKIVELVIPKNGSVKNDVLSGLTVALALVPEAIAFSFILGIDPTIG
LYAAFIMGIVTALLGGRPGMISGATGSVAVIFAPLVISKVQTSGMESALGYLFIAVLLMG
ILQVFFGISKVGKFVRLIPHPVMLGFVNGLAIIIFLSQIGQFYGADGNLLPWPILSIMLV
LIAITMAISIFLPKITRAVPATLVAIITVTIISYFLNNAGYTVLTVLDFIKSIEPLKTTL
AVSMPSFALPNVPLNWDTIKTVLPYSFLAACVGLIESLMTLRLIDELTETRGRSNKECIG
QGIANILNGFFGGMGGCAMIGQSMINIRGGGRGRLSGASAAVLLLVFIVWGAPIIEMIPL
AALVGVMFIVVIGTFEWSSFRILKKIPLSDAVIIAVVSIMTVVLDLATAVFLGIILAALV
FAWDRGKDVWASTKSMKNKKVYMLHGPLFFASTSKFKDLFDYENDPIDVVIDFNKSRVYD
HSAIEAINTVAEKYTQHGKQLHLLNLSKDCDKLIKKADNIVEVSILDNLIWHVADDKLE