Protein Info for MMP_RS03350 in Methanococcus maripaludis S2

Annotation: winged helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 90 to 110 (21 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details PF12840: HTH_20" amino acids 14 to 61 (48 residues), 32.7 bits, see alignment E=1.8e-11 PF01022: HTH_5" amino acids 18 to 62 (45 residues), 44.4 bits, see alignment E=3.6e-15 PF14947: HTH_45" amino acids 21 to 89 (69 residues), 27.4 bits, see alignment E=8.2e-10 PF09339: HTH_IclR" amino acids 21 to 63 (43 residues), 22.9 bits, see alignment 1.8e-08 PF03965: Penicillinase_R" amino acids 33 to 81 (49 residues), 24.9 bits, see alignment E=6.7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0637)

Predicted SEED Role

"Transcriptional regulator, ArsR family member"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZJ0 at UniProt or InterPro

Protein Sequence (180 amino acids)

>MMP_RS03350 winged helix-turn-helix domain-containing protein (Methanococcus maripaludis S2)
MTGLEVNKKFLKALSSRSRISILKALGNKNYTVTELSKSLKLSKSTVHEHLSILVDGELV
KKNEDGRKWVYYGLTEKGQYLIMNDLEKMIILFPMSVIVFLSGLYSILFLKLGSRIVPRE
LNVYSANALKSAESDAVAFGISETATTAGSDLNLLIGTGLILISLLIAYHVISKITYKSN