Protein Info for MMP_RS03290 in Methanococcus maripaludis S2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 TIGR02173: putative cytidylate kinase" amino acids 1 to 174 (174 residues), 201.9 bits, see alignment E=3.7e-64 PF13189: Cytidylate_kin2" amino acids 2 to 159 (158 residues), 69.9 bits, see alignment E=6.4e-23 PF13238: AAA_18" amino acids 3 to 122 (120 residues), 57 bits, see alignment E=5.9e-19 PF13207: AAA_17" amino acids 7 to 118 (112 residues), 53.7 bits, see alignment E=5.7e-18

Best Hits

Swiss-Prot: 100% identical to KCY_METMP: Cytidylate kinase (cmk) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00945, cytidylate kinase [EC: 2.7.4.14] (inferred from 100% identity to mmp:MMP0626)

Predicted SEED Role

"Cytidylate kinase (EC 2.7.4.25)" (EC 2.7.4.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZK1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>MMP_RS03290 AAA family ATPase (Methanococcus maripaludis S2)
MIITVGGLPGTGTTTTSKLLSEKYGLNHVCAGFIFRDMAKEMNMTLQEFSSYAETNTEVD
NEIDRRQVEAAQSGDLILEGRLAGWILKRSDIKPDLSIWLKADPMVRCIRISERENENVD
LALEKMISREASEKKRYKEIYNIEIDDLSIYDLTIESSKWDAKGVFNIIEKAIDNLKA