Protein Info for MMP_RS03250 in Methanococcus maripaludis S2

Annotation: MJ1244 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF10126: Nit_Regul_Hom" amino acids 1 to 106 (106 residues), 156.1 bits, see alignment E=1.4e-50

Best Hits

Swiss-Prot: 100% identical to Y618_METMI: Uncharacterized protein in radB 5'region from Methanococcus maripaludis

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0618)

Predicted SEED Role

"Uncharacterized protein MMP0618"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW49 at UniProt or InterPro

Protein Sequence (109 amino acids)

>MMP_RS03250 MJ1244 family protein (Methanococcus maripaludis S2)
MRILLKLFVESQNLGKAINALSEGGISGFYLKEYQGMSPDDWKGFLLAEEPEMAIKIVNE
LSQDTVVINSIVNIECLGKIKELVRKKLENDRYTLVELPVLGMEVNSPE