Protein Info for MMP_RS03225 in Methanococcus maripaludis S2

Annotation: acetolactate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01252: alpha-acetolactate decarboxylase" amino acids 37 to 254 (218 residues), 250.4 bits, see alignment E=7.3e-79 PF03306: AAL_decarboxy" amino acids 38 to 253 (216 residues), 285.7 bits, see alignment E=1e-89

Best Hits

Swiss-Prot: 58% identical to ALDC_METMA: Alpha-acetolactate decarboxylase (MM_0639) from Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)

KEGG orthology group: K01575, acetolactate decarboxylase [EC: 4.1.1.5] (inferred from 100% identity to mmp:MMP0613)

Predicted SEED Role

"Alpha-acetolactate decarboxylase (EC 4.1.1.5)" in subsystem Acetoin, butanediol metabolism or Alpha-acetolactate operon (EC 4.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZL2 at UniProt or InterPro

Protein Sequence (266 amino acids)

>MMP_RS03225 acetolactate decarboxylase (Methanococcus maripaludis S2)
MNRFVKFLIVIMVLFSGCISTNDNSVSEIKSEQVSDVLYQVSTINALMESIYDGFVPVDE
LVTHGDFGIGTFDKLDGEMVVLDGICYQVKADGVAYRVENVTTPFATVTSFENDETYYLD
NMNISEFESYFESKFPSKNMVYAVKLTGNFSKMKTRSVPSQEKPYEKLVDVVKNQSVFEF
ENVSGTVVGFWVPEFMSGLNVPLYHLHFITDDRLAGGHILDFEIDSVEASFDTTPEFYMV
LPTSGEFYSMEFSDNLENDLKAVEKQ