Protein Info for MMP_RS03180 in Methanococcus maripaludis S2

Annotation: serine protein kinase RIO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF01163: RIO1" amino acids 74 to 251 (178 residues), 192 bits, see alignment E=4e-61

Best Hits

Swiss-Prot: 61% identical to RIO1_METJA: RIO-type serine/threonine-protein kinase Rio1 (rio1) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07178, RIO kinase 1 [EC: 2.7.11.1] (inferred from 100% identity to mmp:MMP0604)

Predicted SEED Role

"Serine/threonine-protein kinase RIO1 (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZM0 at UniProt or InterPro

Protein Sequence (273 amino acids)

>MMP_RS03180 serine protein kinase RIO (Methanococcus maripaludis S2)
MKDVLKMDLDKKEKQLDREFQKKIVERKKKFLEELKTENEVFDQRTLLNIYNLLVAKHID
EISGVVNSGKEAVVFSANKEDELYALKVYRVSTCDFKTMWKYIRGDPRFHLRRSSTRQII
TAWVEKEFRNLLRAGDYINTPEPLLKRENILLMDMVHEDGVPAPRLKDIEVDYSEFYEMI
KEDMKVLYQDAQLVHGDLSEYNILVHEEEPVYIDFSQGVVKEHPLSKTLLIRDVKNVCNF
FKRKGIDTDYKEFYKFVSGEELALIDEEMAKTY