Protein Info for MMP_RS03095 in Methanococcus maripaludis S2

Annotation: diphthine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 TIGR00522: diphthine synthase" amino acids 1 to 254 (254 residues), 376.9 bits, see alignment E=2.3e-117 PF00590: TP_methylase" amino acids 1 to 219 (219 residues), 64.4 bits, see alignment E=7.2e-22

Best Hits

Swiss-Prot: 100% identical to DPHB_METMP: Diphthine synthase (dphB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00586, diphthine synthase [EC: 2.1.1.98] (inferred from 100% identity to mmp:MMP0588)

MetaCyc: 51% identical to diphthine synthase monomer (Pyrococcus horikoshii)
Diphthine synthase. [EC: 2.1.1.98]

Predicted SEED Role

"Diphthine synthase (EC 2.1.1.98)" (EC 2.1.1.98)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.98

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZN6 at UniProt or InterPro

Protein Sequence (255 amino acids)

>MMP_RS03095 diphthine synthase (Methanococcus maripaludis S2)
MLVMAGLGLYDERDVTLKTLDFAKKVDKIYAEFYTAILTGTTMEKIEGTLQKPITVLDRE
KVEYETNKLIDEAKDKDIMFLTAGDPMVATTHVDIAVEARKKGIEVVIINAPSIYSAIGI
TGLQLYKFGKTTSIVFPEPNYFPETPYDVIKDNLKLGYHTLCLLDIQADKERFMTANEGL
DALLKIEEKRKENVISEETEVAVVARAGSINPGLYYGKIKDLLNYDFKSPLHCVIIPGKL
HFMEEDALKYLFENI