Protein Info for MMP_RS03065 in Methanococcus maripaludis S2

Annotation: AzlC family ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 17 to 35 (19 residues), see Phobius details amino acids 42 to 84 (43 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details PF03591: AzlC" amino acids 19 to 158 (140 residues), 150.1 bits, see alignment E=2.6e-48

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0582)

Predicted SEED Role

"Branched-chain amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZP2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>MMP_RS03065 AzlC family ABC transporter permease (Methanococcus maripaludis S2)
MKQLSFNKLYFEGIKDAIPISIGYLPIGMAFGVLAKSMGIPYEISILMSLIIFAGASQFV
GVNLIAIGTSSFEIVLTTFILNLRHFLMSSSLSQRIDYTKSKKFLSLISFGVTDETFAVA
SLKEELKLSPEFLFGLNFTAFFAWNFGTVLGIFLAESIPKEIQSSMGISLYVMFIGLLIP
AVRRSTKVLKIFLVAVFISSALTWVPVFKFISTGWIIIITTIVASFIGAKFIHGDGDE