Protein Info for MMP_RS03055 in Methanococcus maripaludis S2

Annotation: anaerobic ribonucleoside-triphosphate reductase activating protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR02495: anaerobic ribonucleoside-triphosphate reductase activating protein" amino acids 3 to 189 (187 residues), 173.1 bits, see alignment E=2.2e-55 PF13353: Fer4_12" amino acids 20 to 130 (111 residues), 43.5 bits, see alignment E=4.1e-15 PF04055: Radical_SAM" amino acids 22 to 176 (155 residues), 92.6 bits, see alignment E=3.2e-30

Best Hits

Swiss-Prot: 58% identical to Y1227_METJA: Putative glycyl-radical enzyme activating enzyme MJ1227 (MJ1227) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to mmp:MMP0580)

Predicted SEED Role

"Ribonucleotide reductase of class III (anaerobic), activating protein (EC 1.97.1.4)" in subsystem Ribonucleotide reduction (EC 1.97.1.4)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZP4 at UniProt or InterPro

Protein Sequence (236 amino acids)

>MMP_RS03055 anaerobic ribonucleoside-triphosphate reductase activating protein (Methanococcus maripaludis S2)
LKISGIVELSTIDYPKHASAVVFLSGCNMKCGYCQNYEYITTNISEMTAEEVFNSMDLMF
AEALVISGGEPTLQPEAVLELAKIAKGKGFPVKLDTNGTNPDLVEKLISNNLLNYIAIDV
KAGFNNYEKITGYKKEIKENILKIIDLCKKEGIFVECRTTFIPELMDESDIEEIAKTVKN
CNLYAIQQFDREHSYDKELCNVKRISEDDLIALGKIAKKYIENVKIKTLSSEIPIN