Protein Info for MMP_RS02930 in Methanococcus maripaludis S2

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF03602: Cons_hypoth95" amino acids 17 to 176 (160 residues), 31.1 bits, see alignment E=1.1e-10 PF05175: MTS" amino acids 27 to 193 (167 residues), 156.4 bits, see alignment E=3.1e-49 PF00398: RrnaAD" amino acids 48 to 148 (101 residues), 29.5 bits, see alignment E=2.5e-10 PF06325: PrmA" amino acids 48 to 158 (111 residues), 41.8 bits, see alignment E=5.9e-14 PF13489: Methyltransf_23" amino acids 53 to 163 (111 residues), 27.1 bits, see alignment E=1.9e-09 PF12847: Methyltransf_18" amino acids 54 to 175 (122 residues), 31.2 bits, see alignment E=1.3e-10 PF13847: Methyltransf_31" amino acids 54 to 158 (105 residues), 38.3 bits, see alignment E=7e-13 PF10294: Methyltransf_16" amino acids 54 to 175 (122 residues), 32.2 bits, see alignment E=5.4e-11 PF09445: Methyltransf_15" amino acids 59 to 128 (70 residues), 24.6 bits, see alignment E=1e-08 PF13649: Methyltransf_25" amino acids 59 to 154 (96 residues), 35.7 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 62% identical to Y882_METJA: Probable S-adenosylmethionine-dependent methyltransferase MJ0882 (MJ0882) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0554)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZS0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>MMP_RS02930 class I SAM-dependent methyltransferase (Methanococcus maripaludis S2)
MHYFSENPDSKHDESTISGMLRGKRFSFKTDSGVFSPKKIDKGTIILVEELELSKDDDVL
DVGCGYGVIGISIADEVNSVTMTDLNNRSVGLTRKNIKLNGKSEKNIEVFQGDLFEKVNN
KKYSVIISNPPIKAGKELIHKIISKGHNLLNENGSIWVVIQTKHGAKSLTKYMEEIFGNV
ETVTISGGYRVLKSVNMGSE