Protein Info for MMP_RS02920 in Methanococcus maripaludis S2

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 139 (134 residues), 61.8 bits, see alignment E=4.3e-21 amino acids 149 to 284 (136 residues), 60.7 bits, see alignment E=9.5e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0552)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZS2 at UniProt or InterPro

Protein Sequence (296 amino acids)

>MMP_RS02920 DMT family transporter (Methanococcus maripaludis S2)
MNKVKGTAYTIYSSVAFGIMPFLTKFAYDGGANAVTTLMFRFLIAGLILYVFLKFKKISL
KISRHNFVEILFYGAFLYALNTVFLYEAYNYIPTGIATTLHFIYPVTVTLLMISIFKENL
GINKVLALIFSFLGMYCLLGGNCAGFDIYGVLLAAGSGLVYAGYIVSAGKCKYSKIDSYV
TIFYLSILSSVLLFIYGLFTNTLTLNMAFSSYASIGLISIFCTVLALIAFLEGIKLIGPS
NTAILSTLEPIVSIILGILLLNEVLSFKIGLGSVLVLISVIIVTIEKSKVSDTVKN