Protein Info for MMP_RS02915 in Methanococcus maripaludis S2

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 162 to 167 (6 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 9 to 108 (100 residues), 98.5 bits, see alignment E=1.3e-32 PF00528: BPD_transp_1" amino acids 36 to 203 (168 residues), 82.2 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 40% identical to TCYB_BACSU: L-cystine transport system permease protein TcyB (tcyB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to mmp:MMP0551)

Predicted SEED Role

"Putative transport system permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZS3 at UniProt or InterPro

Protein Sequence (219 amino acids)

>MMP_RS02915 amino acid ABC transporter permease (Methanococcus maripaludis S2)
MKFYIVFDNIPFIIDAVFVTLKITIMSFLLAVIIAVLVGSTRAMNFSKTLDLVLMAYVEV
FRGTPLLIQLFFIYYGLPSIGITMSSTFAAVLGLSLNGGAYISEIIRAAIQSVPVGQFEA
AESLGMGKIESMVYIVLPQAFRITIPPLVNSFSSILKESSLISVLAITELTRIGQLIYTR
TSRPFEIYLTIGLIYLILVSIISIGSWKIEKKLNGAFER