Protein Info for MMP_RS02880 in Methanococcus maripaludis S2

Annotation: AmmeMemoRadiSam system radical SAM enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR04337: AmmeMemoRadiSam system radical SAM enzyme" amino acids 7 to 332 (326 residues), 330.9 bits, see alignment E=3.9e-103 PF13353: Fer4_12" amino acids 77 to 168 (92 residues), 23.5 bits, see alignment E=6.3e-09 PF04055: Radical_SAM" amino acids 79 to 233 (155 residues), 84.1 bits, see alignment E=1.3e-27

Best Hits

Swiss-Prot: 59% identical to Y808_METJA: Uncharacterized protein MJ0808 (MJ0808) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to mmp:MMP0544)

Predicted SEED Role

"COG1180: Radical SAM, Pyruvate-formate lyase-activating enzyme like"

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZS9 at UniProt or InterPro

Protein Sequence (336 amino acids)

>MMP_RS02880 AmmeMemoRadiSam system radical SAM enzyme (Methanococcus maripaludis S2)
MLKEALFYENLENCKVKCNLCPKHCVISSGRRGICGGRENIDCKLYAVNYGKICATAVDP
IEKKPLFNYKPGTSVFSIATAGCNFRCKHCQNWEISQSLPEDVPFSELTPEDVVDLAKNY
LCEGIAYTYTEPTIFYEFMQETAKIAKNNDLFNVMVTNGYIEKEPLKKLSIDAMNIDIKG
NSEFYKKICFAELEPVLETCILAKKLGIHVEITNLIVPTYNDNQKDIEFIINFVKDELGV
DTPLHFTAFYPHYKLTSVPSTSIDVIKKARDMALNAGLNYVYAGNVPFSAGYDTYCPDCK
SIVVDRFGYQKPKLHLDTSSKTPKCPKCGRKIDMIL