Protein Info for MMP_RS02865 in Methanococcus maripaludis S2

Annotation: phosphoserine phosphatase SerB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00338: phosphoserine phosphatase SerB
  • amino acids 6 to 210 (205 residues), 274.6 bits, E=5.6e-86
• PF00702: Hydrolase
  • amino acids 8 to 181 (174 residues), 85.7 bits, E=1.5e-27
• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 9 to 180 (172 residues), 114.7 bits, E=4.7e-37
• PF12710: HAD
  • amino acids 10 to 178 (169 residues), 80.9 bits, E=4.2e-26
• PF13419: HAD_2
  • amino acids 10 to 185 (176 residues), 29.2 bits, E=2.4e-10
• PF08282: Hydrolase_3
  • amino acids 143 to 203 (61 residues), 38 bits, E=4e-13

Best Hits

Swiss-Prot: 64% identical to SERB_METJA: Phosphoserine phosphatase (MJ1594) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to mmp:MMP0541)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

• L-serine biosynthesis I (3/3 steps found)
• superpathway of L-serine and glycine biosynthesis I (3/4 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (4/9 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

See Q6LZT2 at UniProt or InterPro

Protein Sequence (213 amino acids)

>MMP_RS02865 phosphoserine phosphatase SerB (Methanococcus maripaludis S2)
MTDNLVKKLILFDLDSTLADCEVIDEIAKFAGVESEIKKITNEAMKGNINFEESLRRRVR
LLKGIPVEKLNKFAETIPVMNGAPELILELKKQGYVTAVVSGGFDFGAEHVKKVLGLDYS
YANTLLSENGILTGEVIGPVMSETAKGDILEKIAANENISLKNTVVVGDGANDISMFEKA
GFKIAFCAKEILRSKADICIDKKDLKEILNHIN