Protein Info for MMP_RS02765 in Methanococcus maripaludis S2
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to Y352_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0352 (TM_0352) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
KEGG orthology group: K02003, (no description) (inferred from 100% identity to mmp:MMP0523)MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427
Predicted SEED Role
"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (1/7 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZV0 at UniProt or InterPro
Protein Sequence (234 amino acids)
>MMP_RS02765 ABC transporter ATP-binding protein (Methanococcus maripaludis S2) MYKIISLEDVWKIYQMGEVEVQALKGVSLDVNKGDFVAIVGSSGSGKSTMMNMIGCLDVP TKGEVYLKSKNISNMNESELSELRGKTIGFVFQQYNLIPNMTALENVLLPLQIQEVNDST AERSAERALKQVGLEDRMNNKPSQLSGGQQQRVSIARALACDPEIILADEPTGALDSATG KEIINLFTALWESGKTIIMITHDQKLAKYAKTIVELKDGKIINIIDNKPNAVHE