Protein Info for MMP_RS02730 in Methanococcus maripaludis S2

Annotation: ModD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR01334: modD protein" amino acids 4 to 279 (276 residues), 224.5 bits, see alignment E=8.9e-71 PF02749: QRPTase_N" amino acids 22 to 104 (83 residues), 56.4 bits, see alignment E=3e-19 PF01729: QRPTase_C" amino acids 108 to 268 (161 residues), 108.3 bits, see alignment E=3.6e-35

Best Hits

KEGG orthology group: K03813, molybdenum transport protein [EC: 2.4.2.-] (inferred from 100% identity to mmp:MMP0516)

Predicted SEED Role

"Molybdenum transport system protein ModD" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZV7 at UniProt or InterPro

Protein Sequence (283 amino acids)

>MMP_RS02730 ModD protein (Methanococcus maripaludis S2)
MSFYIPDYELEKIIEEDINPLDLTSQIMKLDRFNAKLAYKARHDMVLCCTEEAERICKIL
GLEVISYKRTGSYVKEGEVFFEAKGRADNVHLAWKSVLRLLEGYCGMATRTYEFVTLARK
YNENTNVVTTRKNLAGTKKPTIKAIVAGGAYPHRLGLSETILIFDEHLAFVDGDEELKCV
LKEMKANALEKKIGIEVDNFETGIKYVKMGFDYIQLDKVDSKTVEKFVKAAKEINPNITI
VAAGGITIQNIEEYAKTGAEVIVTSALYFGKAADIKTIIEKID