Protein Info for MMP_RS02715 in Methanococcus maripaludis S2

Annotation: molybdopterin molybdotransferase MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 277 to 295 (19 residues), see Phobius details PF03453: MoeA_N" amino acids 2 to 156 (155 residues), 127.2 bits, see alignment E=7.3e-41 TIGR00177: molybdenum cofactor synthesis domain" amino acids 166 to 289 (124 residues), 110.7 bits, see alignment E=2.9e-36 PF00994: MoCF_biosynth" amino acids 169 to 294 (126 residues), 101 bits, see alignment E=7.5e-33 PF03454: MoeA_C" amino acids 309 to 367 (59 residues), 28.7 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 100% identity to mmp:MMP0513)

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZW0 at UniProt or InterPro

Protein Sequence (373 amino acids)

>MMP_RS02715 molybdopterin molybdotransferase MoeA (Methanococcus maripaludis S2)
MISVPEAENILKKFKFEKTENVDLFNSYGRIIARDIVSKQNIPDFRKSNMDGYAVTSPCL
ESYVLIDEVHAGDFRDLKIEGNECVWVATGGKVPEEAHCVIPVENTIIENKIMGIIEIPD
NTYVVEKGSDISNGDLVLKKGSLINERNIGLIASLGISELKVYKTPKVAIISTGDELEKI
SDVNSKSIAGIVKKAGCEPVFLGISKDDKTELRNKLIKALNYDVIVTSGGVSAGKRDFTS
EIIEELGTVLFHGVMMRPGKPVLGGEIDGIPIICMPGKVTSCIICSYLFLYPLLCRYSNS
KKCKKIVNAKIMGEFKKEADKRFYLPVVYDNGFVKPVFKDSSHITSIAYSNAIVELKEGI
SVADGEVEVWIYD