Protein Info for MMP_RS02705 in Methanococcus maripaludis S2

Annotation: formylmethanofuran dehydrogenase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR03129: formylmethanofuran dehydrogenase subunit B" amino acids 8 to 432 (425 residues), 585.2 bits, see alignment E=3e-180 PF00384: Molybdopterin" amino acids 53 to 410 (358 residues), 46.2 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 44% identical to FWDB_METJA: Tungsten-containing formylmethanofuran dehydrogenase 2 subunit B (fwdB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00201, formylmethanofuran dehydrogenase subunit B [EC: 1.2.99.5] (inferred from 100% identity to mmp:MMP0511)

Predicted SEED Role

"Formylmethanofuran dehydrogenase (molybdenum) subunit B (EC 1.2.99.5) @ selenocysteine-containing" (EC 1.2.99.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZW2 at UniProt or InterPro

Protein Sequence (443 amino acids)

>MMP_RS02705 formylmethanofuran dehydrogenase subunit B (Methanococcus maripaludis S2)
MASQTFKDIVCPVCGGACDDIEIVWDEEKRDLTVRNACKLGAAKFKEIISHHRIMSPQIR
KNGVLVDVSWEEALEKAAEILANSKRPLLYMGAETSCEAMTTGLHMGEYLGGIVDSCSTV
*HGPSLMGVQEAGKAGSTAGETKNRADVVIYWGTNPMDSMPRHLSRYGVFPRGYFVEKGR
NSRTVITIDPRKSATAKASDIHLQLNPSTDYELFSAFMMASRGKRPHPSIEKVTGIPVDT
IMETVELIKNAKFASIYGGLGLASSFGKQRNIECVMTLVKELQRYTKVTIGLIRGHCNVA
GFNVLASYLYGFPFGLDFAKGYPRYNPGEFTANDVLREKEVDCAFIMASDVGAHYPQDSV
SHLKNIPVITLDIAPCPSTSVADVVLPGVIDALECDGTFYRFDEIPIYYKPFAKSPFDFT
KSNEDTMEQLFELVKEIKERNGQ