Protein Info for MMP_RS02700 in Methanococcus maripaludis S2
Annotation: formylmethanofuran dehydrogenase subunit C
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00202, formylmethanofuran dehydrogenase subunit C [EC: 1.2.99.5] K00203, formylmethanofuran dehydrogenase subunit D [EC: 1.2.99.5] (inferred from 100% identity to mmp:MMP0510)Predicted SEED Role
"Formylmethanofuran dehydrogenase (molybdenum) subunit C (EC 1.2.99.5) / Formylmethanofuran dehydrogenase (molybdenum) subunit D (EC 1.2.99.5)" in subsystem Methanogenesis (EC 1.2.99.5)
MetaCyc Pathways
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
- methanogenesis from H2 and CO2 (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 II (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 I (5/6 steps found)
- reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
- methoxylated aromatic compound degradation II (6/9 steps found)
- superpathway of methanogenesis (11/21 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.2.99.5
Use Curated BLAST to search for 1.2.99.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6LZW3 at UniProt or InterPro
Protein Sequence (415 amino acids)
>MMP_RS02700 formylmethanofuran dehydrogenase subunit C (Methanococcus maripaludis S2) MGEIILKPKYNGTIPVECDVITPDTFEGKSKEEISALKTFIGPEEHLLSDIFEISGDFTS QKEDMVIKIAGDAGNVKLIGFQMTAGKIIVEGDAGFHVGCEMKGGEILVKGDVKPWAGRE MEGGTLHIFGNAGDHLGGCYRGRWEGMLGGTIIVEGDAGNNVGDGMVDGKIVVNGNVRAF CGIRLNGGVLYVGGNAIRAVGVEMKKGTIIVAGKIKNFAPGFISTGVVSDYETGLSGLAL PGKLIGFNGDQAFFNKPKGKLYVSLSENYDLLNDELPAKERPIEFKGNALKVILNTGSTI EQGRIIKGGNKYSHEYLDVCAVCNMHPEDYILLGKPEKVKVSSENGKYSVLVRAEPNEDV LRRNVFIPRSVWANVIVDAYSVSTGSPIYKGGTVYVEPSEGEILEAEYIIDNIYR