Protein Info for MMP_RS02575 in Methanococcus maripaludis S2

Annotation: CAAX prenyl protease Rce1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 245 to 261 (17 residues), see Phobius details PF02517: Rce1-like" amino acids 126 to 232 (107 residues), 61 bits, see alignment E=5.5e-21

Best Hits

Swiss-Prot: 100% identical to RCE1_METMP: CAAX prenyl protease 2 (rce1) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07052, (no description) (inferred from 100% identity to mmp:MMP0485)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6LZY8 at UniProt or InterPro

Protein Sequence (271 amino acids)

>MMP_RS02575 CAAX prenyl protease Rce1 (Methanococcus maripaludis S2)
MISSYKYNPKLYFLSTFVVTYILWFTGAYLSFSSTYSGIYMLIMLPGLMAPFIISTILIA
KSKNNELKKDFINRLFNLKLINLKTIPVVFLLMPAVILLSILLSIPFGGSISQFQFSGGF
SFSTDFVPVLFLLLLAATFEELGWRGYAFDSLQSRYSLFKASILFGIFWSLWHFPLIFVN
NSYQYEIFNQSIWYGLNFFLSILPMGIIITWMCLKNRKSIILAIIFHFLINLNQELLAIT
QDTKIIETGVLFLVAAAIILYDKKMFFEKLG