Protein Info for MMP_RS02275 in Methanococcus maripaludis S2

Annotation: Ni-sirohydrochlorin a c-diamide reductive cyclase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR03282: putative methanogenesis marker 13 metalloprotein" amino acids 4 to 362 (359 residues), 478.5 bits, see alignment E=5.9e-148 PF00148: Oxidored_nitro" amino acids 11 to 139 (129 residues), 53 bits, see alignment E=1.4e-18

Best Hits

Swiss-Prot: 67% identical to CFBD_METJA: Ni-sirohydrochlorin a,c-diamide reductive cyclase complex, component CfbD (cfbD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0428)

Predicted SEED Role

"Nitrogenase vanadium-cofactor synthesis protein VnfN" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M043 at UniProt or InterPro

Protein Sequence (366 amino acids)

>MMP_RS02275 Ni-sirohydrochlorin a c-diamide reductive cyclase catalytic subunit (Methanococcus maripaludis S2)
MILHPRPSPIAAAMYQLRDIGVDAIILHGPSGCCFRTARLLEIDGIRVFTSAMGENDFIF
GAMDKLRDVIAEVLEYLKKETPKSEKYKIGIVGTCASMIIGEDLESLIDDFDDIIIPVDI
HSGLVDNTVGAIRAMDGALNAGLIDYSEYERQKKMLVCATDVEKKRGMAKNRYLKPTYED
DLEKFMNILKETDSKRKQGKDVKIACVLNAKKETAYLFSDPLLELNKHFECTNIANLDEN
IGFDKVRADAKNILEEFSKCGFKIDYITGGLDEYPITGEKALDYLKEINPDIVVVSGVPH
ALLIENLKEINPDVITVGISDGPRLYHPIKEVYSYGIIELDAHAKVLGKKNIVKSRFGEI
LSFMKF