Protein Info for MMP_RS02270 in Methanococcus maripaludis S2

Annotation: replication factor C small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF03215: Rad17" amino acids 3 to 69 (67 residues), 32.5 bits, see alignment E=2.9e-11 PF05496: RuvB_N" amino acids 10 to 63 (54 residues), 27.3 bits, see alignment 9.9e-10 PF00004: AAA" amino acids 39 to 158 (120 residues), 61.8 bits, see alignment E=3.4e-20 PF13177: DNA_pol3_delta2" amino acids 79 to 159 (81 residues), 38.3 bits, see alignment E=5e-13 PF21960: RCF1-5-like_lid" amino acids 167 to 206 (40 residues), 31.2 bits, see alignment 6.2e-11 PF08542: Rep_fac_C" amino acids 225 to 310 (86 residues), 89.8 bits, see alignment E=4.1e-29

Best Hits

Swiss-Prot: 100% identical to RFCS_METMP: Replication factor C small subunit (rfcS) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K04801, replication factor C small subunit (inferred from 100% identity to mmp:MMP0427)

Predicted SEED Role

"Replication factor C small subunit" in subsystem DNA replication, archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M044 at UniProt or InterPro

Protein Sequence (315 amino acids)

>MMP_RS02270 replication factor C small subunit (Methanococcus maripaludis S2)
MQKPWVEKYRPETLSEVVGHHEIIKRLTNYVEKKSMPHLLFSGSPGVGKTTAALALAKDL
YGDTWRENFLELNSSDERGIDVIRTKVKDFARTKPIGDAPFKVIFLDESDALTSDAQNAL
RRTMEKYSDICRFILSCNYPSKIIPPIQSRCAIFRFSPLKTEDLVENLKDISEKENLNLE
KGGIDAIIYVSEGDMRKAINVLQTAAAVSDEITEEIVYKVASKARPDEIKKMTQLALNGK
FVEAREQLYNLMIDWGMSGEDILIQVFREVPNLDISEKEKVHLVEAIGECDFRIVEGSNE
RIQLSALLAKMGILE