Protein Info for MMP_RS02160 in Methanococcus maripaludis S2

Annotation: GTP cyclohydrolase IIa

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF05165: GCH_III" amino acids 5 to 250 (246 residues), 363.3 bits, see alignment E=2.8e-113

Best Hits

Swiss-Prot: 100% identical to GCH3_METMP: GTP cyclohydrolase III (gch3) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K08096, GTP cyclohydrolase IIa [EC: 3.5.4.29] (inferred from 100% identity to mmp:MMP0405)

MetaCyc: 77% identical to GTP cyclohydrolase III monomer (Methanocaldococcus jannaschii)
GTP cyclohydrolase IIa. [EC: 3.5.4.29]

Predicted SEED Role

"GTP cyclohydrolase III (EC 3.5.4.29)" in subsystem Riboflavin, FMN and FAD metabolism (EC 3.5.4.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M066 at UniProt or InterPro

Protein Sequence (266 amino acids)

>MMP_RS02160 GTP cyclohydrolase IIa (Methanococcus maripaludis S2)
MIQITVVQIDNYGPWTVTPNPRRESDLQALQSRLYCDMNLQFGAHKGLAFYTRFDNIIAI
TNGIDLETHKRIQNSVKNRYPFTVSMAVASAETAYEAQKLATKTIQEYGSAQDDVRKEVL
DVANEFVSNGYVQLAHVDINDITGKLTDLETAYDTYLSVQKTKLKLMEELKKYDSLGFFI
GGDNFMCPCNGMNEKDFLCMFEDIKDSCGIELKAGIGIGKTAEDASNLADIGLEVIREGK
TDSQVYTLKQEIDEQKNVPYNYMCPI