Protein Info for MMP_RS02155 in Methanococcus maripaludis S2

Annotation: 2-phospho-L-lactate transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF01933: CofD" amino acids 3 to 277 (275 residues), 170.2 bits, see alignment E=3.1e-54 TIGR01819: 2-phospho-L-lactate transferase" amino acids 3 to 304 (302 residues), 388.6 bits, see alignment E=7.9e-121

Best Hits

Swiss-Prot: 100% identical to COFD_METMP: 2-phospho-L-lactate transferase (cofD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K11212, LPPG:FO 2-phospho-L-lactate transferase [EC: 2.7.8.28] (inferred from 100% identity to mmp:MMP0404)

MetaCyc: 65% identical to LPPG:Fo 2-phospho-L-lactate transferase subunit (Methanocaldococcus jannaschii)
RXN-21089 [EC: 2.7.8.28]

Predicted SEED Role

"Lactyl (2) diphospho-(5')guanosine:7,8-didemethyl-8-hydroxy-5-deazariboflavin 2-phospho-L-lactate transferase" in subsystem Coenzyme F420 synthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M067 at UniProt or InterPro

Protein Sequence (309 amino acids)

>MMP_RS02155 2-phospho-L-lactate transferase (Methanococcus maripaludis S2)
MKITILSGGTGTPKLIQGFKEILPNEDISVIVNTGEDTYIGDIYLSPDIDTVLYTFSNLI
NDETWYGLKGDTFFCHEQLKNFGFDEVLRIGDKDRALKMHKTSLLKKGVPMSEIVDIERK
SLSINSKIYPMSDEKIESKVLIEENNEKILLKFHDFWVSRRGNAKVLDIFYENSNYAKAA
DGVLKAIEESDFVIIGPSNPITSIGPILSISEIKDALKEKLVFAVSPIVGENPVSGPAGT
LMHAKGYPVNAVGVYEYYKDIVDVLVLDNSDINKKKEMNCEVLYANTIMKTIDDKITLAR
NILDYYKSR