Protein Info for MMP_RS02145 in Methanococcus maripaludis S2

Annotation: winged helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 200 to 220 (21 residues), see Phobius details PF24034: DUF7343" amino acids 369 to 428 (60 residues), 68.7 bits, see alignment E=8.1e-23 PF12802: MarR_2" amino acids 369 to 418 (50 residues), 35.2 bits, see alignment 2.8e-12 PF13412: HTH_24" amino acids 374 to 416 (43 residues), 31.6 bits, see alignment 2.4e-11 PF01047: MarR" amino acids 375 to 418 (44 residues), 30.2 bits, see alignment 8.2e-11 PF09339: HTH_IclR" amino acids 376 to 417 (42 residues), 29.7 bits, see alignment 1.1e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0402)

Predicted SEED Role

"Chromosome partition protein smc" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M069 at UniProt or InterPro

Protein Sequence (436 amino acids)

>MMP_RS02145 winged helix-turn-helix transcriptional regulator (Methanococcus maripaludis S2)
MFCSISAVDSYRFDEYSVIYSIDQNDNFYEEIDLKIYNNNSDDLYEISYTIPQETSNLTF
NSSKEIDSYSITTDDAGSTEVSVRLTEPIGPWQTGDLLVSFTGEVSDIGGKKQVYIIVPA
FDSTFKLSVQLPEGAAIVSPVKDVLSISPRDYTVGSNGKSIFVEWEKELTSEEKYFEVTI
NYVLTGVITPSTTGENNEDLYRAISIVLGVLVVALIFFIYRNYNKVKMINELQNEINGLN
KGLEISHLNLQNKNKELQRLEELNEHVLKELDLSKNTLRDYELKINELNEEILQCRAQVG
NHTKLKEELNSKDAVIKSLNDYKKLSEELKLKINELTGLISEKEKCIIKLKEKIGDYESH
KSETLMNILTDDEKQLIELIREHGSISQKEIVDITGLTKPKVSRMISDLEQRGMVRKVKI
GRINKIALSDDLDGSI