Protein Info for MMP_RS02105 in Methanococcus maripaludis S2

Annotation: uroporphyrinogen-III synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to HEM4_METJA: Putative uroporphyrinogen-III synthase (hemD) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01719, uroporphyrinogen-III synthase [EC: 4.2.1.75] (inferred from 100% identity to mmp:MMP0394)

Predicted SEED Role

"Uroporphyrinogen-III synthase (EC 4.2.1.75)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.2.1.75)

MetaCyc Pathways

adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
adenosylcobalamin biosynthesis II (aerobic) (24/33 steps found)
tetrapyrrole biosynthesis II (from glycine) (3/4 steps found)
superpathway of heme b biosynthesis from glutamate (7/10 steps found)
superpathway of heme b biosynthesis from glycine (4/8 steps found)
superpathway of bacteriochlorophyll a biosynthesis (4/26 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.75

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M077 at UniProt or InterPro

Protein Sequence (244 amino acids)

>MMP_RS02105 uroporphyrinogen-III synthase (Methanococcus maripaludis S2)
MKVVITRPAEKGKDFSNLLEKNGFETVILPTLELVFKKAQINLENYSWIVFTSPRGVEGF
FRNLKLEDAKKVLTKKIGAIGTETAKEFERTFGKAVDVIPKQYTAENLLEAIQKQVKNGE
KVLVPTTPSTRDVLKEGLNADLVFVYSSEEPTDIPEKLKELEKQVISENSQDKKLILTFT
SGLTAKNFFKHCSPEFLEILKKQYIVSIGPITKKNVDSFGFDSLMPEKNYTVEAMVPVIK
ALNI