Protein Info for MMP_RS02035 in Methanococcus maripaludis S2

Annotation: ribosome biogenesis/translation initiation ATPase RLI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 PF04068: RLI" amino acids 3 to 32 (30 residues), 43.9 bits, see alignment (E = 9.7e-15) PF00037: Fer4" amino acids 44 to 67 (24 residues), 30.2 bits, see alignment (E = 1.7e-10) PF00005: ABC_tran" amino acids 98 to 241 (144 residues), 64.3 bits, see alignment E=1.2e-20 amino acids 361 to 481 (121 residues), 72.2 bits, see alignment E=4.3e-23

Best Hits

Swiss-Prot: 73% identical to Y719_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0719 (MJ0719) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06174, ATP-binding cassette, sub-family E, member 1 (inferred from 100% identity to mmp:MMP0382)

Predicted SEED Role

"RNase L inhibitor" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M089 at UniProt or InterPro

Protein Sequence (590 amino acids)

>MMP_RS02035 ribosome biogenesis/translation initiation ATPase RLI (Methanococcus maripaludis S2)
MSRLAILDYDRCQPRRCSMECMKYCPGVRMEEETIVMDENLGKPIISEELCSGCGICTKR
CPFGAIRIIGLPEELTDDRIVHSYGQNRFRLYGLITPRDGVTGLLGPNGVGKSTIIKALS
GEMVLNLNDLTETPDMKKVLDYFSGTELQNYFEKLKNNGIKPIHKPQYVDVLPKVVKGKV
GELLKKVDEKGEFEKIINALEISNILDRTFDQLSGGELQRVAIAAACLREGDIYYFDEPT
SWLDVKQRFSAAKVIREVAEGKKVVAVEHDLIVLDYLSDYIHIMYGIPSAYGVVTHPRGT
RVGINTYLDGFLKEENIRFRKSPIVFEKRPPQDSTNRPLLLDYTDISKKLGDFSLNVNGG
QIYQGEVVGILGPNGIGKTTFVKALAGVISPDSGEVTGDVKVSYKPQYISSDFEGTVEDL
LMSITAIHTSYYKSEIIKPLALENILDSSVKDLSGGELQRVSIAACLSQDADLYLIDEPS
AFLDVEQRLTTSRVIRRMADEKEAAMFVVDHDILFQDYISDRFIVFSGIAGSSGTGSEPL
QKRAGANKFLKEMGITFRRDPDTGRPRVNKEGSQRDVYQKEIGEYYYLDE