Protein Info for MMP_RS01970 in Methanococcus maripaludis S2

Annotation: TIGR04279 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 654 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR04279: TIGR04279 domain" amino acids 358 to 648 (291 residues), 47.4 bits, see alignment E=8.6e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0369)

Predicted SEED Role

"Predicted cell-wall-anchored protein SasA (LPXTG motif)" in subsystem Adhesins in Staphylococcus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0A2 at UniProt or InterPro

Protein Sequence (654 amino acids)

>MMP_RS01970 TIGR04279 domain-containing protein (Methanococcus maripaludis S2)
LKIINFFIPILLLLSAIPMGFASSENVVVIASTPADAILAAQYAKEMGYKFVYTPSDSLS
EAAGNAITGASHAIMIGGPDAISETVKSQLEAKISNVERVYGADRVDTSLALLERMYTEK
PEALNNVVFAEGFNGDITPAALNFGAPIAYFAPDNYEKVSAFISSHPVKNAVIMGSSVPD
TLRNAVSNAADTTNLALGSAETIIETALSVASNLNPSILGSVAALVYSESVNDPVIDAIL
GYASGDVGSVVPLPSDDEGTVNEIVLSVTAITSTISISSDSTAVSESISESVPAGTTTTT
TTSSSGGGSSSTPYYTQYYTVVSINNVEKVKFADISASATDGNNVKITGDDSIVLPDLTI
TTNMVQKSYTGSSGTVKISYQGTGSGLNIVYPVESGALTYGSDLDVTFYGSRALANTQVT
AHVITDRQEFRDSMNDLLDGNANTFISMLNNADTVTSTTNYYGDATFTVTPSTYGENIVI
VTLGDGTIGTTATVLGVSGFEYLKYDLNLTQMWFNPLDNTTEISMDLNETPANNVRYGLI
GITKSGYSFTFDIIGTSTADKNFDVSLVGNGGTSKVIDDSALVSLTASSIQNILEAAFTE
NTAGITYSYVTKDVNFPATVSINAQGQDCYFVGVVYDLNDKKIVAMEQISGNLS