Protein Info for MMP_RS01940 in Methanococcus maripaludis S2

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF20030: bpMoxR" amino acids 7 to 202 (196 residues), 46.9 bits, see alignment E=4.4e-16 PF07726: AAA_3" amino acids 37 to 167 (131 residues), 201.3 bits, see alignment E=1.2e-63 PF07728: AAA_5" amino acids 37 to 165 (129 residues), 54.5 bits, see alignment E=3.2e-18 PF00004: AAA" amino acids 38 to 172 (135 residues), 27.3 bits, see alignment E=1.1e-09 PF17863: AAA_lid_2" amino acids 230 to 301 (72 residues), 58.5 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 46% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to mmp:MMP0363)

Predicted SEED Role

"Methanol dehydrogenase regulatory protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0A8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>MMP_RS01940 MoxR family ATPase (Methanococcus maripaludis S2)
MEGKEFLSKIETEISKCVVGKENIIKLLLISMLSKGHVLLEGIPGLAKTTIVKNFAKTFG
LSFSRIQLTPDTMPSDIIGVYYYSEKTKDFAIKKGPIFTNILLADEINRTPPKTQSAMLE
AMQEGQATVEGTSIKLPEPFILLATMNPLESEGVYSLPEAQMDRFMFKITLEYPKKDEEI
TMLKKKYEGSFETVNSVISPEELKKAFEKVLEIKISDEILEYIYEIVKMTRTDDRLLYGV
SPRASEQILYASRALAYLNGRNYVIPDDVKEVSKYVIVHKIKLKIDYEIEGISNKNIVNE
ILDKAVVFKKNQG