Protein Info for MMP_RS01925 in Methanococcus maripaludis S2

Annotation: DUF1616 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details PF07760: DUF1616" amino acids 10 to 291 (282 residues), 298.9 bits, see alignment E=2e-93

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0360)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0B1 at UniProt or InterPro

Protein Sequence (323 amino acids)

>MMP_RS01925 DUF1616 domain-containing protein (Methanococcus maripaludis S2)
MNLKKTWDLVLIIFLSITLNFFIFFSPENPLRIVLGLPFVLFFPGYVFINLLFKKENSLE
NIERFALSFGLSIAIVPLIGLLLNYSPYGIRIIPIMISITLFIMLFAIIGIYNRNTVNEP
WFPKINIEELKNDFEWKTSSKLDKFLTVILIISVIASVMTLGYVISAPKQNEKFTEFYLL
GPEGKAYDYPTNVFTNEKNEVIIGLVNHEGKSVNYSIEVWLVNLTYDMNINQTNISNMYI
MDEIPVNLDNRPVHIDENWTKQWETNYNFSIDTSGKWQQWYLLFKNTDKEEFETLKSLTP
EEKIKFALNGSIQSLKLNINVND