Protein Info for MMP_RS01840 in Methanococcus maripaludis S2

Annotation: TIGR00289 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR00290: MJ0570-related uncharacterized domain" amino acids 1 to 223 (223 residues), 291.2 bits, see alignment E=8e-91 PF01902: Diphthami_syn_2_N" amino acids 1 to 115 (115 residues), 151.8 bits, see alignment E=7.5e-49 TIGR00289: TIGR00289 family protein" amino acids 1 to 222 (222 residues), 316.7 bits, see alignment E=1.1e-98 TIGR03679: arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein" amino acids 5 to 217 (213 residues), 287.3 bits, see alignment E=9.2e-90 PF28410: Diphthami_syn_2_C" amino acids 124 to 220 (97 residues), 110.6 bits, see alignment E=3.4e-36

Best Hits

Swiss-Prot: 67% identical to Y570_METJA: Uncharacterized protein MJ0570 (MJ0570) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06927, (no description) (inferred from 97% identity to mmx:MmarC6_0609)

Predicted SEED Role

"conserved hypothetical protein [Pyrococcus horikoshii]; COG2102: Predicted ATPases of PP-loop superfamily; IPR002761: Domain of unknown function DUF71"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0C8 at UniProt or InterPro

Protein Sequence (223 amino acids)

>MMP_RS01840 TIGR00289 family protein (Methanococcus maripaludis S2)
MKIASLYSGGKDSAYALFWALNQGWDVNYLVNVASKNKESYMFHIPNVELTDLVSESTGI
EMIKVITKGEKEKEILDLQKNLEKLDIDGIVSGALASEYQRARIDHICEEIGIKSFAPLW
HKDQELILRDTSKFFDFRMVSVAAYGLDKKWLGKRIDETNIEELLKIMEKYQINKAFEGG
EAETFVFDAPFFEKKIEVLDYEIIWDGISGSYNIKDAELVSKK