Protein Info for MMP_RS01775 in Methanococcus maripaludis S2

Annotation: TIGR00297 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details PF01940: DUF92" amino acids 13 to 225 (213 residues), 199.6 bits, see alignment E=2.9e-63 TIGR00297: TIGR00297 family protein" amino acids 13 to 233 (221 residues), 232.2 bits, see alignment E=3.5e-73

Best Hits

Swiss-Prot: 54% identical to Y933_METJA: Uncharacterized membrane protein MJ0933 (MJ0933) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0333)

Predicted SEED Role

"COG1836"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0D8 at UniProt or InterPro

Protein Sequence (237 amino acids)

>MMP_RS01775 TIGR00297 family protein (Methanococcus maripaludis S2)
MDMLLKIIYSAAITGLLAALIYKKKYLDKWGIFGSSVMAFTILFLADLKWLLLLISFLVL
GSLVSKMGYGFKKTIKMAESRRSLKNVLANGLMAILFVLAYSSGFITEEIALVGYVGAIA
AANSDTFSSELGMLSRETPRLISNFKTVKTGTDGGITVCGTFAGLLGSFLIGLLAYALFN
DILMFWTATISGMIGNFADSFLGAFFERKGILNNEHVNFMATLSGGTFAVLFYQLVL