Protein Info for MMP_RS01735 in Methanococcus maripaludis S2

Annotation: type II glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF01113: DapB_N" amino acids 3 to 108 (106 residues), 27 bits, see alignment E=4.1e-10 TIGR01546: glyceraldehyde-3-phosphate dehydrogenase, type II" amino acids 4 to 338 (335 residues), 492.5 bits, see alignment E=3e-152 PF02800: Gp_dh_C" amino acids 146 to 300 (155 residues), 112.5 bits, see alignment E=1.5e-36

Best Hits

Swiss-Prot: 100% identical to G3P_METMP: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00150, glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC: 1.2.1.59] (inferred from 100% identity to mmp:MMP0325)

Predicted SEED Role

"NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase archaeal (EC 1.2.1.59)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 1.2.1.59)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0E6 at UniProt or InterPro

Protein Sequence (340 amino acids)

>MMP_RS01735 type II glyceraldehyde-3-phosphate dehydrogenase (Methanococcus maripaludis S2)
MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAVEKGYKLFAAIPERKHL
FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDIKTGP
VNAIVPNPVTVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
DALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKALGLIK