Protein Info for MMP_RS01735 in Methanococcus maripaludis S2
Annotation: type II glyceraldehyde-3-phosphate dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to G3P_METMP: Glyceraldehyde-3-phosphate dehydrogenase (gap) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K00150, glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC: 1.2.1.59] (inferred from 100% identity to mmp:MMP0325)Predicted SEED Role
"NAD(P)-dependent glyceraldehyde 3-phosphate dehydrogenase archaeal (EC 1.2.1.59)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 1.2.1.59)
MetaCyc Pathways
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis IV (8/10 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- gluconeogenesis I (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- glycolysis III (from glucose) (8/11 steps found)
- homolactic fermentation (8/12 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- Bifidobacterium shunt (10/15 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- oxygenic photosynthesis (10/17 steps found)
- superpathway of glucose and xylose degradation (10/17 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
- Entner-Doudoroff pathway I (4/9 steps found)
- superpathway of hexitol degradation (bacteria) (10/18 steps found)
- glycerol degradation to butanol (8/16 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
- superpathway of N-acetylneuraminate degradation (10/22 steps found)
- heterolactic fermentation (7/18 steps found)
- ethene biosynthesis V (engineered) (12/25 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 1.2.1.59
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6M0E6 at UniProt or InterPro
Protein Sequence (340 amino acids)
>MMP_RS01735 type II glyceraldehyde-3-phosphate dehydrogenase (Methanococcus maripaludis S2) MANVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEAKMAVEKGYKLFAAIPERKHL FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDIKTGP VNAIVPNPVTVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII DALAKTPRILTVKASEGFDSTAKIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKALGLIK