Protein Info for MMP_RS01710 in Methanococcus maripaludis S2

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01920: shikimate kinase
  • amino acids 8 to 271 (264 residues), 283.8 bits, E=6.4e-89
• PF00288: GHMP_kinases_N
  • amino acids 59 to 147 (89 residues), 53.2 bits, E=2.8e-18
• PF08544: GHMP_kinases_C
  • amino acids 230 to 268 (39 residues), 24.5 bits, 2.9e-09

Best Hits

Swiss-Prot: 100% identical to AROK_METMP: Shikimate kinase (aroK) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to mmp:MMP0320)

MetaCyc: 64% identical to shikimate kinase (Methanocaldococcus jannaschii)
Shikimate kinase. [EC: 2.7.1.71]

Predicted SEED Role

"Shikimate kinase II (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (17/18 steps found)
• chorismate biosynthesis II (archaea) (12/12 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• superpathway of L-tyrosine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis I (6/7 steps found)
• superpathway of chorismate metabolism (25/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

See Q6M0F1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>MMP_RS01710 shikimate kinase (Methanococcus maripaludis S2)
MRCSAVSLGSGTIINAIATGFGSAFGVDLKIKADVELIDNGKKIVNGISIDNPTLKPSLV
ERCVKNVFDHFEVDYSAKISTIGDIPIKSGLSSSSAASNAAVLATIGALGEKVDPDLVLD
LAIKSSFEENLTVTGAYDDATASYFGGITVCNNMERKILKKDKFKEDIKVIVLMPEFKKN
VDVNRMKLIKDYVDMAFEKCMNGDYYKALFLNGLLYSSALNFPSNISVDALEAGAITAGL
SGTGPSYVALCYFEDEKNVENALKKYGETTITKPSNDGAKILY