Protein Info for MMP_RS01680 in Methanococcus maripaludis S2

Annotation: phenylacetate--CoA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 PF00501: AMP-binding" amino acids 66 to 273 (208 residues), 46.6 bits, see alignment E=2.3e-16 PF14535: AMP-binding_C_2" amino acids 322 to 413 (92 residues), 81.7 bits, see alignment E=3.8e-27

Best Hits

Swiss-Prot: 46% identical to PAAK_ECOLI: Phenylacetate-coenzyme A ligase (paaK) from Escherichia coli (strain K12)

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 100% identity to mmp:MMP0314)

MetaCyc: 44% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30)" in subsystem Aromatic amino acid interconversions with aryl acids (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.30

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0F7 at UniProt or InterPro

Protein Sequence (414 amino acids)

>MMP_RS01680 phenylacetate--CoA ligase (Methanococcus maripaludis S2)
MNNKQLETYALVKKLLRHVSEGSEFYKNKFSKAGINIDEISSLEDFKKIPFTEKEELRSA
YPLGLQAVPDEKIVRIHSSSGTTGSPVIIPYTQKDVDTWSEMMMRCYQMAGVTNKDRIQI
TPGYGLWTAGIGFQLGAERLGAMAIPMGPGNTEKQLQMMVDLKSTILTSTSSYALLLAEE
IRKKGIHDKIHLKIGVIGSERWSEKMRNRIESELGIKSFDIYGLTEIYGPGIALDCEYHE
GMHYWSDHLLFEIIDPVTGENLPDGELGELVITTLTKEGAPLIRYRTRDLTRIIPEKCKC
GSEYPRIDRILGRADDRIKIKGVNIYPGQIEDLIHKLNGVSSEYQIVLSRFEGRDSMLFR
VEVDVLEKDFEETKLAIIKAFKTYIGISPDVECLKVGELPRSEKKSRRVFDNRD