Protein Info for MMP_RS01660 in Methanococcus maripaludis S2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF02676: TYW3" amino acids 5 to 191 (187 residues), 164.5 bits, see alignment E=1.1e-52

Best Hits

Swiss-Prot: 58% identical to TYW3_METJA: tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase (taw3) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0310)

MetaCyc: 40% identical to tRNA isowyosine37 7-methyltransferase 1 (Pyrococcus abyssi)
RXN-14519 [EC: 2.1.1.282]; 2.1.1.- [EC: 2.1.1.282]

Predicted SEED Role

"tRNA methylase YGL050w homolog Wyeosine biosynthesis" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.282

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0G1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>MMP_RS01660 hypothetical protein (Methanococcus maripaludis S2)
MFNDDKEFTLKKLQEALDNDFVDLEVMYLVDKINEFKDYYTTSSCIGRCGIIEFPKDKNP
KINSRWLGKWHHYANYDEIDEALLKKSENFEKISFVLNSPILHVASRNADTSKKLLELAY
HNGLKASSIKSISSKRYIVEIMTTAKMDAPIAYDGKMVVNREYLDILLDEGNLKLKHARK
SLKRFYEKLNELQD