Protein Info for MMP_RS01615 in Methanococcus maripaludis S2

Annotation: hydrogenase maturation nickel metallochaperone HypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 TIGR00100: hydrogenase nickel insertion protein HypA" amino acids 1 to 121 (121 residues), 101.6 bits, see alignment E=1.4e-33 PF01155: HypA" amino acids 1 to 117 (117 residues), 96.9 bits, see alignment E=3.8e-32

Best Hits

Swiss-Prot: 100% identical to HYPA_METMP: Hydrogenase maturation factor HypA (hypA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K04651, hydrogenase nickel incorporation protein HypA (inferred from 100% identity to mmp:MMP0301)

Predicted SEED Role

"[NiFe] hydrogenase nickel incorporation protein HypA" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0H0 at UniProt or InterPro

Protein Sequence (126 amino acids)

>MMP_RS01615 hydrogenase maturation nickel metallochaperone HypA (Methanococcus maripaludis S2)
MHELSYATSVLNAILDAVKQQEELGRKVIKVNDINLEIGDLTLISLDQLQFVFEVISEDT
ICKGAELKAEMVKPKIFCNDCEFEGNLDTKDELEVVCPKCESRNIKLKGGKEFNIVNATI
EFDDEE