Protein Info for MMP_RS01595 in Methanococcus maripaludis S2

Annotation: translation initiation factor IF-2 subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00311: putative translation initiation factor aIF-2, beta subunit
  • amino acids 6 to 137 (132 residues), 190.9 bits, E=3.8e-61
• PF01873: eIF-5_eIF-2B
  • amino acids 24 to 131 (108 residues), 129 bits, E=4.2e-42

Best Hits

Swiss-Prot: 100% identical to IF2B_METMP: Translation initiation factor 2 subunit beta (eif2b) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03238, translation initiation factor 2 subunit 2 (inferred from 99% identity to mmx:MmarC6_0656)

Predicted SEED Role

"Eukaryotic translation initiation factor 2 beta subunit" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

See Q6M0H3 at UniProt or InterPro

Protein Sequence (138 amino acids)

>MMP_RS01595 translation initiation factor IF-2 subunit beta (Methanococcus maripaludis S2)
MVDYFDYSSLLTRAREQLPEEVFKDVRFEIPSADSFVEGNRTIIKNFKDIAKFMERDPQE
FAKYVMKELGTAGDMEGVRLILQGKFGWRMVNEKIQNYVNEYVLCPECGKPDTKIVKEGR
IHFLKCTACGAMKPVKTL