Protein Info for MMP_RS01585 in Methanococcus maripaludis S2

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00191: homoserine kinase
  • amino acids 4 to 281 (278 residues), 276.9 bits, E=7.5e-87
• PF00288: GHMP_kinases_N
  • amino acids 65 to 148 (84 residues), 69.7 bits, E=2e-23
• PF08544: GHMP_kinases_C
  • amino acids 206 to 283 (78 residues), 35.9 bits, E=8.3e-13

Best Hits

Swiss-Prot: 100% identical to KHSE_METMP: Homoserine kinase (thrB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00872, homoserine kinase [EC: 2.7.1.39] (inferred from 100% identity to mmp:MMP0295)

MetaCyc: 61% identical to homoserine kinase monomer (Methanocaldococcus jannaschii)
Homoserine kinase. [EC: 2.7.1.39]

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)
• aspartate superpathway (18/25 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

See Q6M0H5 at UniProt or InterPro

Protein Sequence (301 amino acids)

>MMP_RS01585 homoserine kinase (Methanococcus maripaludis S2)
MKKVKVCSPGTSANLGPGYDIFGLALSNPYDIVEVEKTENGITISVEGEKAEEIPTNVDE
NTAGVVAKKMIEDFKIESGIHIHIIKGIKPGSGLGSSSASCAGIAFALNELFELKLSKLE
LVKYSSLGEAVAAGAPHADNVAPAIFGGFTLTTSYEPLEVLHIPVDLEVLVALPNIQVST
KTAREILPKEIPIKDMVNNVGKAAGMVYALYNNDLDLFGRYMSKDCVVEPCRANLIDGYT
EVKEKVKDMVYGITISGSGPAIITIPKKEHVIDIENIFKEVWNCPVYYTKVGPGCYVEEI
E