Protein Info for MMP_RS01535 in Methanococcus maripaludis S2

Annotation: DHH family phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF02254: TrkA_N" amino acids 2 to 115 (114 residues), 79.6 bits, see alignment E=3.4e-26 PF01368: DHH" amino acids 170 to 310 (141 residues), 41.5 bits, see alignment E=2.3e-14 PF02272: DHHA1" amino acids 370 to 468 (99 residues), 39.5 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: K06881, (no description) (inferred from 100% identity to mmp:MMP0285)

Predicted SEED Role

"Kef-type K+ transport systems (NAD-binding component fused to domain related to exopolyphosphatase)" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0I5 at UniProt or InterPro

Protein Sequence (486 amino acids)

>MMP_RS01535 DHH family phosphoesterase (Methanococcus maripaludis S2)
MILVIGYGSLGRKVVNNAKNIDKVTVIDKNEAVFESLENGDFNYVIGDASELDVLERAKV
KEADTLLVLTNDYELNRKIVEITSELNSKAYIIARGIIKYPELYNGLDINKIIYPLESAA
KDAVNEIEKSKLRRKLAELKEVANKAKKSFNEHYSEKEDETQENHKAPFLILMHRNPDPD
AMASAMALKTIFDKWGVNSEIAYGGKIGYDENKAMVNLLSIKLNQIDEINLSRYCSIAVV
DSSSAKTLPIDIEGSKLAVIIDHHNDSDIVAKYMDIMPEIGATATILTNYLLGLDITPNR
DLATALYYAITSDTNYFKRKTSKKDFEAASYLQGLMDPKVLEMIENPDMDTETMEILGKA
IMNRKIIKGNLALSYVGTLKNRDALPRAAEFLLKMEGISTTYIFGIAENEIHISSRTKDL
RVDVGNIMKTAFGGGGHQSSAAASVELGIFQSVSDKQSLRKLVEEAIQAKIFETMGIEEE
EPAGQD